PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG771000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 344aa    MW: 37038.1 Da    PI: 5.9418
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG771000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1315.6e-10192244557
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                          kr +r   NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a
  Pavir.9NG771000.1.p 192 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATTLSAQLALLQRDSA 244
                          999****************************************9999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-16188252IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588190253IPR004827Basic-leucine zipper domain
PfamPF001702.6E-9192244IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-10192244No hitNo description
SuperFamilySSF579594.66E-11192242No hitNo description
CDDcd147032.77E-23193244No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEVDAAAARK AHHRRSRSDV PFGYFPPASG GAQLPPPKVE AGWGHHPGGD ADDLFNAYLN  60
LDGLNSSDER HDDGDSRGSS IKTNGADSSE NESEECAADS RAGIRLWGAE GLKRSAAGEP  120
AGAPMARHAR SLSMDSLIGK LNFSAGAAAN GAVIAGPNRF SLEFGSGEFS PVEMKKIMAD  180
EKLAEMALAD PKRVKRVLAN RQSAARSKER KMRYIAELEQ KVQILQTEAT TLSAQLALLQ  240
RDSAGIATQN NELKFRLQAM EQQAQLRDAL NEALTAEVQR LKIATAELGD SCSSNNLAQQ  300
LQLSAQDQMF QLQHQQQQAT PIPFYQLQQA QQNGAGKNQD STE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715090.0EU971509.1 Zea mays clone 366380 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151643.10.0DNA binding protein precursor
TrEMBLB6U2P40.0B6U2P4_MAIZE; DNA binding protein
STRINGSi035841m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.39e-65bZIP family protein